Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G044101.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HD-ZIP
Protein Properties Length: 842aa    MW: 91293.1 Da    PI: 5.9818
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G044101.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
                           688999***********************************************999 PP

                 START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                           ela++a++elvk+a+ eep+W ks+    + +n++e++++f +  +     + ++a+r+sg+v+ ++  lve+l++++ +W e+++   
                           5899*************************************99888999999**************************.********** PP

                 START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepk 157
                            + +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  +++++  +s++ +++lpSg++++++
                           ********************************************************************999****************** PP

                 START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           + g+skvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
                           ***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.216127187IPR001356Homeobox domain
SMARTSM003899.9E-18128191IPR001356Homeobox domain
CDDcd000861.38E-18129187No hitNo description
PfamPF000461.4E-18130185IPR001356Homeobox domain
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PROSITE profilePS5084843.618326563IPR002913START domain
SuperFamilySSF559611.65E-34328560No hitNo description
CDDcd088758.70E-122330559No hitNo description
PfamPF018523.4E-58335560IPR002913START domain
SMARTSM002341.5E-50335560IPR002913START domain
SuperFamilySSF559619.89E-24589759No hitNo description
SuperFamilySSF559619.89E-24794834No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091553.10.0Homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein